Recombinant Human SKA2 protein, T7/His-tagged
Cat.No. : | SKA2-195H |
Product Overview : | Recombinant human SKA2 cDNA (121aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT . |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLL KELSVIKSRYQTLYARFKPVAVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human SKA2 mediated neuronal response with stress hormones regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | SKA2 spindle and kinetochore associated complex subunit 2 [ Homo sapiens ] |
Official Symbol | SKA2 |
Synonyms | SKA2; spindle and kinetochore associated complex subunit 2; FAM33A, family with sequence similarity 33, member A; spindle and kinetochore-associated protein 2; FLJ12758; spindle and KT (kinetochore) associated 2; family with sequence similarity 33, member A; FAM33A; MGC110975; |
Gene ID | 348235 |
mRNA Refseq | NM_001100595 |
Protein Refseq | NP_001094065 |
MIM | |
UniProt ID | Q8WVK7 |
Chromosome Location | 17q23.2 |
Pathway | Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; Mitotic Prometaphase, organism-specific biosystem; |
Function | microtubule binding; protein binding; |
◆ Recombinant Proteins | ||
SKA2-15168M | Recombinant Mouse SKA2 Protein | +Inquiry |
SKA2-5413R | Recombinant Rat SKA2 Protein | +Inquiry |
SKA2-660C | Recombinant Cynomolgus Monkey SKA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SKA2-8191M | Recombinant Mouse SKA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SKA2-3748H | Recombinant Human SKA2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SKA2 Products
Required fields are marked with *
My Review for All SKA2 Products
Required fields are marked with *
0
Inquiry Basket