Recombinant Human SKA2 Protein, GST-tagged

• Cat.No.: SKA2-3748H
• Product Overview: Human FAM33A full-length ORF (BAG51725.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: SKA2 (Spindle And Kinetochore Associated Complex Subunit 2) is a Protein Coding gene. Diseases associated with SKA2 include Post-Traumatic Stress Disorder. Among its related pathways are Mitotic Metaphase and Anaphase and Signaling by GPCR. GO annotations related to this gene include microtubule binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40.6 kDa
• AA Sequence: MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVEQKESKSRICATAKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SKA2 spindle and kinetochore associated complex subunit 2 [ Homo sapiens (human) ]
• Official Symbol: SKA2
• Synonyms: SKA2; spindle and kinetochore associated complex subunit 2; Spindle And Kinetochore Associated Complex Subunit 2; Family With Sequence Similarity 33, Member A; FAM33A; Spindle And Kinetochore-Associated Protein 2; Spindle And KT (Kinetochore) Associated 2; Protein FAM33A; spindle and kinetochore-associated protein 2; family with sequence similarity 33, member A; spindle and KT (kinetochore) associated 2
• Gene ID: 348235
• mRNA Refseq: NM_001100595
• Protein Refseq: NP_001094065
• MIM: 616674
• UniProt ID: Q8WVK7