Recombinant Human SIVA1 Protein (1-110 aa), His-SUMO-tagged
Cat.No. : | SIVA1-812H |
Product Overview : | Recombinant Human SIVA1 Protein (1-110 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-110 aa |
Description : | Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 27.8 kDa |
AA Sequence : | MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | SIVA1 SIVA1, apoptosis-inducing factor [ Homo sapiens ] |
Official Symbol | SIVA1 |
Synonyms | SIVA1; CD27BP; SIVA; Siva 1; Siva 2; Siva-1; Siva-2; |
Gene ID | 10572 |
mRNA Refseq | NM_006427 |
Protein Refseq | NP_006418 |
MIM | 605567 |
UniProt ID | O15304 |
◆ Recombinant Proteins | ||
SIVA1-4967H | Recombinant Human SIVA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SIVA1-812H | Recombinant Human SIVA1 Protein (1-110 aa), His-SUMO-tagged | +Inquiry |
SIVA1-277H | Recombinant Human SIVA1, apoptosis-inducing factor, His-tagged | +Inquiry |
SIVA1-4209R | Recombinant Rhesus monkey SIVA1 Protein, His-tagged | +Inquiry |
SIVA1-4923C | Recombinant Chicken SIVA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIVA1-1826HCL | Recombinant Human SIVA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIVA1 Products
Required fields are marked with *
My Review for All SIVA1 Products
Required fields are marked with *
0
Inquiry Basket