Recombinant Human SIGLEC6 Protein, Fc-tagged

• Cat.No.: SIGLEC6-446H
• Product Overview: Recombinant human SIGLEC6 protein with Fc tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 453
• Description: This gene encodes a member of the SIGLEC (sialic acid binding immunoglobulin-like lectin) family of proteins. The encoded transmembrane receptor binds sialyl-TN glycans and leptin. Placental expression of the encoded protein is upregulated in preeclampsia.
• Form: Lyophilized
• Molecular Mass: 60.3 kDa
• AA Sequence: MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: SIGLEC6 sialic acid binding Ig-like lectin 6 [ Homo sapiens (human) ]
• Official Symbol: SIGLEC6
• Synonyms: SIGLEC6; sialic acid binding Ig-like lectin 6; CD33L, CD33L1; sialic acid-binding Ig-like lectin 6; CD327; OB BP1; SIGLEC 6; CD33 antigen-like 1; obesity-binding protein 1; CD33L; OBBP1; CD33L1; CD33L2; CDW327
• Gene ID: 946
• mRNA Refseq: NM_001177547
• Protein Refseq: NP_001171018
• MIM: 604405
• UniProt ID: O43699