Recombinant Full Length Human Sialic Acid-Binding Ig-Like Lectin 6(Siglec6) Protein, His-Tagged
Cat.No. : | RFL6654HF |
Product Overview : | Recombinant Full Length Human Sialic acid-binding Ig-like lectin 6(SIGLEC6) Protein (O43699) (27-453aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-453) |
Form : | Lyophilized powder |
AA Sequence : | QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SIGLEC6 |
Synonyms | SIGLEC6; CD33L; CD33L1; OBBP1; Sialic acid-binding Ig-like lectin 6; Siglec-6; CD33 antigen-like 1; CDw327; Obesity-binding protein 1; OB-BP1; CD antigen CD327 |
UniProt ID | O43699 |
◆ Recombinant Proteins | ||
SIGLEC6-146H | Recombinant Human SIGLEC6, Fc tagged | +Inquiry |
SIGLEC6-191H | Recombinant Human SIGLEC6 Protein, His-tagged | +Inquiry |
SIGLEC6-0687H | Recombinant Human SIGLEC6 protein, Fc-tagged | +Inquiry |
RFL6654HF | Recombinant Full Length Human Sialic Acid-Binding Ig-Like Lectin 6(Siglec6) Protein, His-Tagged | +Inquiry |
SIGLEC6-339H | Recombinant Human SIGLEC6 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGLEC6-795HCL | Recombinant Human SIGLEC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIGLEC6 Products
Required fields are marked with *
My Review for All SIGLEC6 Products
Required fields are marked with *
0
Inquiry Basket