Recombinant Human SHMT1, His-tagged

• Cat.No.: SHMT1-31357TH
• Product Overview: Recombinant fragment, corresponding to amino acids 184-483 of Human SHMT1, with N terminal His tag, 300aa, MWt 35kDa,

Specification

• Description: This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitution with 114 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGA YLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRG CRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPG LQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRA LSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVL EACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLE KDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLA GDKYQAAVQALREEVESFASLFPLPGLPDF
• Sequence Similarities: Belongs to the SHMT family.
• Protein length: 184-483 a.a.

Gene Information

• Gene Name: SHMT1 serine hydroxymethyltransferase 1 (soluble) [ Homo sapiens ]
• Official Symbol: SHMT1
• Synonyms: SHMT1; serine hydroxymethyltransferase 1 (soluble); serine hydroxymethyltransferase, cytosolic; 14 kDa protein; CSHMT; cytoplasmic serine hydroxymethyltransferase; MGC15229; MGC24556; SHMT
• Gene ID: 6470
• mRNA Refseq: NM_004169
• Protein Refseq: NP_004160
• MIM: 182144
• Uniprot ID: P34896
• Chromosome Location: 17p11.2
• Pathway: C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Carnitine synthesis, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem
• Function: L-allo-threonine aldolase activity; amino acid binding; glycine hydroxymethyltransferase activity; glycine hydroxymethyltransferase activity; protein homodimerization activity