Recombinant Human SETBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SETBP1-6550H |
Product Overview : | SETBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001123582) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein which contains a several motifs including a ski homology region and a SET-binding region in addition to three nuclear localization signals. The encoded protein has been shown to bind the SET nuclear oncogene which is involved in DNA replication. Mutations in this gene are associated with Schinzel-Giedion midface retraction syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 26.2 kDa |
AA Sequence : | MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEEDELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQIKDSSKEEVWKRRGGQGIPFKKQFLSQERAMCFSCPRNPFPAKPGSLTLPFHSEPAVWAQEVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SETBP1 SET binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | SETBP1 |
Synonyms | SETBP1; SET binding protein 1; SET-binding protein; KIAA0437; SEB; DKFZp666J1210; |
Gene ID | 26040 |
mRNA Refseq | NM_001130110 |
Protein Refseq | NP_001123582 |
MIM | 611060 |
UniProt ID | Q9Y6X0 |
◆ Recombinant Proteins | ||
Setbp1-5798M | Recombinant Mouse Setbp1 Protein, Myc/DDK-tagged | +Inquiry |
SETBP1-2054H | Recombinant Human SETBP1 Protein, His&GST-tagged | +Inquiry |
SETBP1-996H | Recombinant Human SETBP1 Protein, MYC/DDK-tagged | +Inquiry |
SETBP1-6550H | Recombinant Human SETBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETBP1-1587HCL | Recombinant Human SETBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SETBP1 Products
Required fields are marked with *
My Review for All SETBP1 Products
Required fields are marked with *
0
Inquiry Basket