Recombinant Human SEMA6D Protein, GST-tagged

• Cat.No.: SEMA6D-956H
• Product Overview: Human SEMA6D partial ORF ( NP_705871.1, 852 a.a. - 940 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Several transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.53 kDa
• AA Sequence: KLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDIQMAHQNLMLDPMGSMSEVPPKVPNREASLYSPPSTLPRNS

Gene Information

• Gene Name: SEMA6D semaphorin 6D [ Homo sapiens (human) ]
• Official Symbol: SEMA6D
• Synonyms: FLJ11598,KIAA1479
• Gene ID: 80031
• mRNA Refseq: NM_153618
• Protein Refseq: NP_705871.1
• MIM: 609295
• UniProt ID: Q8NFY4