Recombinant Human SCGB2A1 protein(19-95aa), His-tagged
Cat.No. : | SCGB2A1-2239H |
Product Overview : | Recombinant Human SCGB2A1 protein(O75556)(19-95aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Product Overview : | Recombinant Human SCGB2A1 protein(O75556)(19-95aa), fused with N-terminal His tag, was expressed in E.coli. |
Source : | E.coli |
Species : | Human |
Tag : | His |
Protein length : | 19-95aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 14.9 kDa |
AASequence : | DSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | SCGB2A1 secretoglobin, family 2A, member 1 [ Homo sapiens ] |
Official Symbol | SCGB2A1 |
Synonyms | SCGB2A1; secretoglobin, family 2A, member 1; mammaglobin 2 , MGB2; mammaglobin-B; lacryglobin; lipophilin C; LPHC; mammaglobin B; MGC71973; UGB3; lipophilin-C; mammaglobin 2; mammaglobin-2; MGB2; |
Gene ID | 4246 |
mRNA Refseq | NM_002407 |
Protein Refseq | NP_002398 |
MIM | 604398 |
UniProt ID | O75556 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SCGB2A1 Products
Required fields are marked with *
My Review for All SCGB2A1 Products
Required fields are marked with *
0
Inquiry Basket