Recombinant Human SCGB2A1 protein(19-95aa), His-tagged

• Cat.No.: SCGB2A1-2239H
• Product Overview: Recombinant Human SCGB2A1 protein(O75556)(19-95aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Product Overview: Recombinant Human SCGB2A1 protein(O75556)(19-95aa), fused with N-terminal His tag, was expressed in E.coli.
• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 19-95aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 14.9 kDa
• AASequence: DSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SCGB2A1 secretoglobin, family 2A, member 1 [ Homo sapiens ]
• Official Symbol: SCGB2A1
• Synonyms: SCGB2A1; secretoglobin, family 2A, member 1; mammaglobin 2 , MGB2; mammaglobin-B; lacryglobin; lipophilin C; LPHC; mammaglobin B; MGC71973; UGB3; lipophilin-C; mammaglobin 2; mammaglobin-2; MGB2
• Gene ID: 4246
• mRNA Refseq: NM_002407
• Protein Refseq: NP_002398
• MIM: 604398
• UniProt ID: O75556