Recombinant Full Length Human SCGB2A1 Protein, C-Flag-tagged

Cat.No. : SCGB2A1-1262HFL
Product Overview : Recombinant Full Length Human SCGB2A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Involved in androgen receptor signaling pathway. Located in extracellular space.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 10.7 kDa
AA Sequence : MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name SCGB2A1 secretoglobin family 2A member 1 [ Homo sapiens (human) ]
Official Symbol SCGB2A1
Synonyms LPHC; LPNC; MGB2; UGB3
Gene ID 4246
mRNA Refseq NM_002407.3
Protein Refseq NP_002398.1
MIM 604398
UniProt ID O75556

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SCGB2A1 Products

Required fields are marked with *

My Review for All SCGB2A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon