Recombinant Human SCGB2A1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SCGB2A1-949H
• Product Overview: SCGB2A1 MS Standard C13 and N15-labeled recombinant protein (NP_002398) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Product Overview: SCGB2A1 MS Standard C13 and N15-labeled recombinant protein (NP_002398) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
• Description: May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 10.9 kDa
• AA Sequence: MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SCGB2A1 secretoglobin family 2A member 1 [ Homo sapiens (human) ]
• Official Symbol: SCGB2A1
• Synonyms: SCGB2A1; secretoglobin, family 2A, member 1; mammaglobin 2, MGB2; mammaglobin-B; lacryglobin; lipophilin C; LPHC; mammaglobin B; MGC71973; UGB3; lipophilin-C; mammaglobin 2; mammaglobin-2; MGB2
• Gene ID: 4246
• mRNA Refseq: NM_002407
• Protein Refseq: NP_002398
• MIM: 604398
• UniProt ID: O75556