Recombinant Human RSU1

• Cat.No.: RSU1-30419TH
• Product Overview: Recombinant fragment of Human RSU1 with N-terminal proprietary tag. Predicted MW 36.63kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 100 amino acids
• Description: This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
• Sequence Similarities: Contains 7 LRR (leucine-rich) repeats.

Gene Information

• Gene Name: RSU1 Ras suppressor protein 1 [ Homo sapiens ]
• Official Symbol: RSU1
• Synonyms: RSU1; Ras suppressor protein 1; ras suppressor protein 1; FLJ31034; RSP 1
• Gene ID: 6251
• mRNA Refseq: NM_012425
• Protein Refseq: NP_036557
• MIM: 179555
• Uniprot ID: Q15404
• Chromosome Location: 10
• Pathway: Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-extracellular matrix interactions, organism-specific biosystem; Regulation of cytoskeletal remodeling and cell spreading by IPP complex components, organism-specific biosystem