Recombinant Human RSU1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RSU1-5733H
• Product Overview: RSU1 MS Standard C13 and N15-labeled recombinant protein (NP_689937) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors.
• Molecular Mass: 31.5 kDa
• AA Sequence: MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RSU1 Ras suppressor protein 1 [ Homo sapiens (human) ]
• Official Symbol: RSU1
• Synonyms: RSU1; Ras suppressor protein 1; ras suppressor protein 1; FLJ31034; RSP 1; rsu-1; ras suppressor protein 1 variant 1; ras suppressor protein 1 variant 2; ras suppressor protein 1 variant 3; RSP-1
• Gene ID: 6251
• mRNA Refseq: NM_152724
• Protein Refseq: NP_689937
• MIM: 179555
• UniProt ID: Q15404