Recombinant Human RSPO2 protein(22-205aa), His-tagged

• Cat.No.: RSPO2-2214H
• Product Overview: Recombinant Human RSPO2 protein(Q6UXX9)(22-205aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 22-205aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 22.8 kDa
• AASequence: QGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: RSPO2 R-spondin 2 [ Homo sapiens ]
• Official Symbol: RSPO2
• Synonyms: RSPO2; R-spondin 2; R spondin 2 homolog (Xenopus laevis); R-spondin-2; MGC35555; R-spondin 2 homolog; roof plate-specific spondin-2; CRISTIN2; MGC43342
• Gene ID: 340419
• mRNA Refseq: NM_178565
• Protein Refseq: NP_848660
• MIM: 610575
• UniProt ID: Q6UXX9