Active Recombinant Human RSPO2 Protein

• Cat.No.: RSPO2-171H
• Product Overview: Recombinant Human RSPO2 was expressed in CHO cells.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Description: This gene encodes a member of the R-spondin family of proteins. These proteins are secreted ligands of leucine-rich repeat containing G protein-coupled receptors that enhance Wnt signaling through the inhibition of ubiquitin E3 ligases. A chromosomal translocation including this locus that results in the formation of a gene fusion has been identified in multiple human cancers. Alternative splicing results in multiple transcript variants.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Bio-activity: R-Spondin-2 enhances BMP-2 mediated differentiation of MC3T3-E1 cells.
• Molecular Mass: 24.4 kDa
• AA Sequence: ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: RSPO2 R-spondin 2 [ Homo sapiens ]
• Official Symbol: RSPO2
• Synonyms: RSPO2; R-spondin 2; R spondin 2 homolog (Xenopus laevis); R-spondin-2; MGC35555; R-spondin 2 homolog; roof plate-specific spondin-2; CRISTIN2; MGC43342
• Gene ID: 340419
• mRNA Refseq: NM_178565
• Protein Refseq: NP_848660
• MIM: 610575
• UniProt ID: Q6UXX9