Active Recombinant Human RSPO2 Protein
Cat.No. : | RSPO2-171H |
Product Overview : | Recombinant Human RSPO2 was expressed in CHO cells. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Description : | This gene encodes a member of the R-spondin family of proteins. These proteins are secreted ligands of leucine-rich repeat containing G protein-coupled receptors that enhance Wnt signaling through the inhibition of ubiquitin E3 ligases. A chromosomal translocation including this locus that results in the formation of a gene fusion has been identified in multiple human cancers. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Bio-activity : | R-Spondin-2 enhances BMP-2 mediated differentiation of MC3T3-E1 cells. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | RSPO2 R-spondin 2 [ Homo sapiens ] |
Official Symbol | RSPO2 |
Synonyms | RSPO2; R-spondin 2; R spondin 2 homolog (Xenopus laevis); R-spondin-2; MGC35555; R-spondin 2 homolog; roof plate-specific spondin-2; CRISTIN2; MGC43342; |
Gene ID | 340419 |
mRNA Refseq | NM_178565 |
Protein Refseq | NP_848660 |
MIM | 610575 |
UniProt ID | Q6UXX9 |
◆ Recombinant Proteins | ||
RSPO2-2214H | Recombinant Human RSPO2 protein(22-205aa), His-tagged | +Inquiry |
RSPO2-14553M | Recombinant Mouse RSPO2 Protein | +Inquiry |
RSPO2-8354Z | Recombinant Zebrafish RSPO2 | +Inquiry |
RSPO2-42HCL | Recombinant Human RSPO2 HEK293T cell lysate | +Inquiry |
RSPO2-4013H | Recombinant Human RSPO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO2-1645HCL | Recombinant Human RSPO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RSPO2 Products
Required fields are marked with *
My Review for All RSPO2 Products
Required fields are marked with *
0
Inquiry Basket