Recombinant Human RORC protein, His/Flag-tagged

• Cat.No.: RORC-15H
• Product Overview: RAR-Related Orphan Receptor C Human Recombinant produced in E.Coli is a full length protein consisting of 497 amino acids having a molecular weight of 55.8kDa and fused with 5.5kDa amino-terminal His-Flag tag.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Flag
• Form: Sterile filtered colorless solution.RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5.
• AA Sequence: MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYFQGEFMRTQIEVIPCKICGDKSSGIHYGVITCEGCKGF FRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQ QQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHL EYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQS VCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQI VLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALV LINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAF PPLYKELFSTETESPVGLSK
• Purity: Greater than 80.0% as determined by SDS-PAGE.
• Storage: Store at 4 centigrade if entire vial will be used within 2-4 weeks.Store, frozen at -20 centigrade for longer periods of time. Please avoid freeze thaw cycles.
• Full Length: Full L.

Gene Information

• Gene Name: RORC RAR-related orphan receptor C [ Homo sapiens ]
• Official Symbol: RORC
• Synonyms: RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
• Gene ID: 6097
• mRNA Refseq: NM_001001523
• Protein Refseq: NP_001001523
• MIM: 602943
• UniProt ID: P51449
• Chromosome Location: 1q21
• Pathway: Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Gene expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem
• Function: DNA binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; zinc ion binding