Recombinant Human RAR related orphan receptor C protein, His tagged

Cat.No. : RORC-01H
Product Overview : Recombinant Human RORC protein (268-506aa) with N-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 268-506aa
Description : The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.
Tag : N-His
Molecular Mass : 30.2 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELF
Purity : > 85% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : 20mM Tris, 0.5M NaCl, pH 8.0
Concentration : 1.03 mg/mL
Gene Name RORC RAR related orphan receptor C [ Homo sapiens (human) ]
Official Symbol RORC
Synonyms RORC; RAR-related orphan receptor C; nuclear receptor ROR-gamma; NR1F3; RORG; RZRG; TOR; nuclear receptor RZR-gamma; retinoic acid-binding receptor gamma; retinoid-related orphan receptor gamma; RAR-related orphan receptor C, isoform a; RAR-related orphan nuclear receptor variant 2; nuclear receptor subfamily 1 group F member 3; RZR-GAMMA; MGC129539
Gene ID 6097
mRNA Refseq NM_001001523
Protein Refseq NP_001001523
MIM 602943
UniProt ID P51449

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RORC Products

Required fields are marked with *

My Review for All RORC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon