Recombinant Human RNF11 Protein (2-154 aa), His-tagged

Cat.No. : RNF11-2753H
Product Overview : Recombinant Human RNF11 Protein (2-154 aa) is produced by Baculovirus expression system. This protein is fused with a 9xHis tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome.
Source : Baculovirus
Species : Human
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.3 kDa
Protein length : 2-154 aa
AA Sequence : GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RNF11 ring finger protein 11 [ Homo sapiens ]
Official Symbol RNF11
Synonyms RNF11; ring finger protein 11; RING finger protein 11; CGI 123; MGC51169; Sid1669p; CGI-123; SID1669;
Gene ID 26994
mRNA Refseq NM_014372
Protein Refseq NP_055187
MIM 612598
UniProt ID Q9Y3C5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RNF11 Products

Required fields are marked with *

My Review for All RNF11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon