Recombinant Human RNF11 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RNF11-5202H
• Product Overview: RNF11 MS Standard C13 and N15-labeled recombinant protein (NP_055187) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN).
• Molecular Mass: 17.4 kDa
• AA Sequence: MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RNF11 ring finger protein 11 [ Homo sapiens (human) ]
• Official Symbol: RNF11
• Synonyms: RNF11; ring finger protein 11; RING finger protein 11; CGI 123; MGC51169; Sid1669p; CGI-123; SID1669
• Gene ID: 26994
• mRNA Refseq: NM_014372
• Protein Refseq: NP_055187
• MIM: 612598
• UniProt ID: Q9Y3C5