Recombinant Human RNF11 Protein (2-154 aa), His-tagged
Cat.No. : | RNF11-2103H |
Product Overview : | Recombinant Human RNF11 Protein (2-154 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-154 aa |
Description : | Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.3 kDa |
AA Sequence : | GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | RNF11 ring finger protein 11 [ Homo sapiens ] |
Official Symbol | RNF11 |
Synonyms | RNF11; ring finger protein 11; CGI 123; MGC51169; Sid1669p; CGI-123; SID1669; |
Gene ID | 26994 |
mRNA Refseq | NM_014372 |
Protein Refseq | NP_055187 |
MIM | 612598 |
UniProt ID | Q9Y3C5 |
◆ Recombinant Proteins | ||
RNF11-0460H | Recombinant Human RNF11 Protein (G2-N154), His tagged | +Inquiry |
RNF11-3922R | Recombinant Rhesus monkey RNF11 Protein, His-tagged | +Inquiry |
RNF11-2753H | Recombinant Human RNF11 Protein (2-154 aa), His-tagged | +Inquiry |
RNF11-696H | Recombinant Human RNF11 Protein, MYC/DDK-tagged | +Inquiry |
RNF11-3739R | Recombinant Rhesus Macaque RNF11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF11-2310HCL | Recombinant Human RNF11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF11 Products
Required fields are marked with *
My Review for All RNF11 Products
Required fields are marked with *
0
Inquiry Basket