Recombinant Human RNASET2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RNASET2-5129H
• Product Overview: RNASET2 MS Standard C13 and N15-labeled recombinant protein (NP_003721) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.
• Molecular Mass: 29.5 kDa
• AA Sequence: MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RNASET2 ribonuclease T2 [ Homo sapiens (human) ]
• Official Symbol: RNASET2
• Synonyms: RNASET2; ribonuclease T2; bA514O12.3; FLJ10907; RNASE6PL; ribonuclease 6; FLJ42372; RP11-514O12.3
• Gene ID: 8635
• mRNA Refseq: NM_003730
• Protein Refseq: NP_003721
• MIM: 612944
• UniProt ID: O00584

Reviews

01/25/2025

RNase T2 works very well.