Recombinant Full Length Human RNASET2 Protein, C-Flag-tagged

• Cat.No.: RNASET2-408HFL
• Product Overview: Recombinant Full Length Human RNASET2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 29.3 kDa
• AA Sequence: MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPD KSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLE LYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQL
  QNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Secreted Protein
• Full Length: Full L.

Gene Information

• Gene Name: RNASET2 ribonuclease T2 [ Homo sapiens (human) ]
• Official Symbol: RNASET2
• Synonyms: RNASE6PL; bA514O12.3
• Gene ID: 8635
• mRNA Refseq: NM_003730.6
• Protein Refseq: NP_003721.2
• MIM: 612944
• UniProt ID: O00584

Reviews

01/25/2025

RNase T2 works very well.