Recombinant Full Length Human RNASET2 Protein, C-Flag-tagged
Cat.No. : | RNASET2-408HFL |
Product Overview : | Recombinant Full Length Human RNASET2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.3 kDa |
AA Sequence : | MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPD KSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLE LYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQL QNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | RNASET2 ribonuclease T2 [ Homo sapiens (human) ] |
Official Symbol | RNASET2 |
Synonyms | RNASE6PL; bA514O12.3 |
Gene ID | 8635 |
mRNA Refseq | NM_003730.6 |
Protein Refseq | NP_003721.2 |
MIM | 612944 |
UniProt ID | O00584 |
◆ Recombinant Proteins | ||
RNASET2-6652H | Recombinant Human RNASET2 Protein (Asp25-His256), C-His tagged | +Inquiry |
Rnaset2-2022R | Recombinant Rat Rnaset2 Protein, His-tagged | +Inquiry |
RNASET2-702H | Recombinant Human RNASET2 Protein, MYC/DDK-tagged | +Inquiry |
RNASET2-408HFL | Recombinant Full Length Human RNASET2 Protein, C-Flag-tagged | +Inquiry |
RNASET2-1471H | Recombinant Human RNASET2 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASET2-448HCL | Recombinant Human RNASET2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNASET2 Products
Required fields are marked with *
My Review for All RNASET2 Products
Required fields are marked with *
0
Inquiry Basket