Recombinant Human RNASE3, His-tagged

• Cat.No.: RNASE3-5319H
• Product Overview: Recombinant Human Ribonuclease 3/RNASE3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg28-Ile160) of Human RNASE3 fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 28-160 a.a.
• Description: Ribonuclease 3 (RNASE3) is a basic protein that is localized to the eosinophil primary matrix and belongs to the pancreatic ribonuclease family. RNASE3 is released during degranulation of eosinophils. RNASE3 possesses a wide variety of biological activities. RNASE3 interacts with bacterial lipopolysaccharide (LPS) and lipoteichoic acid (LTA). RNASE3 exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. It promotes E. coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content.
• AA Sequence: RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSR FRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTIVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped on dry ice/ice packs.

Gene Information

• Gene Name: RNASE3 ribonuclease, RNase A family, 3 [ Homo sapiens (human) ]
• Official Symbol: RNASE3
• Synonyms: RNASE3； ECP; RNS3； ribonuclease, RNase A family, 3； eosinophil cationic protein； RNase 3； ribonuclease 3； cytotoxic ribonuclease； EC 3.1.27.-
• Gene ID: 6037
• mRNA Refseq: NM_002935
• Protein Refseq: NP_002926
• MIM: 131398
• UniProt ID: P12724
• Chromosome Location: 14q24-q31
• Pathway: Asthma
• Function: nucleic acid binding； pancreatic ribonuclease activity； ribonuclease activity