Recombinant Human RING1

Cat.No. : RING1-29982TH
Product Overview : Recombinant full length Human RING1, isoform 2 with proprietary tag, 64.47kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 377 amino acids
Description : This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4.
Molecular Weight : 67.470kDa inclusive of tags
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK
Sequence Similarities : Contains 1 RING-type zinc finger.
Gene Name RING1 ring finger protein 1 [ Homo sapiens ]
Official Symbol RING1
Synonyms RING1; ring finger protein 1; E3 ubiquitin-protein ligase RING1; RNF1;
Gene ID 6015
mRNA Refseq NM_002931
Protein Refseq NP_002922
MIM 602045
Uniprot ID Q06587
Chromosome Location 6p21.3
Pathway Delta-Notch Signaling Pathway, organism-specific biosystem;
Function chromatin binding; ligase activity; metal ion binding; protein binding; ubiquitin-protein ligase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RING1 Products

Required fields are marked with *

My Review for All RING1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon