Recombinant Human RING1
Cat.No. : | RING1-29982TH |
Product Overview : | Recombinant full length Human RING1, isoform 2 with proprietary tag, 64.47kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 377 amino acids |
Description : | This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. |
Molecular Weight : | 67.470kDa inclusive of tags |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK |
Sequence Similarities : | Contains 1 RING-type zinc finger. |
Gene Name | RING1 ring finger protein 1 [ Homo sapiens ] |
Official Symbol | RING1 |
Synonyms | RING1; ring finger protein 1; E3 ubiquitin-protein ligase RING1; RNF1; |
Gene ID | 6015 |
mRNA Refseq | NM_002931 |
Protein Refseq | NP_002922 |
MIM | 602045 |
Uniprot ID | Q06587 |
Chromosome Location | 6p21.3 |
Pathway | Delta-Notch Signaling Pathway, organism-specific biosystem; |
Function | chromatin binding; ligase activity; metal ion binding; protein binding; ubiquitin-protein ligase activity; |
◆ Recombinant Proteins | ||
RING1-2656H | Recombinant Human RING1 Protein, His-tagged | +Inquiry |
RING1-4711R | Recombinant Rat RING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RING1-29982TH | Recombinant Human RING1 | +Inquiry |
Ring1-5519M | Recombinant Mouse Ring1 Protein, Myc/DDK-tagged | +Inquiry |
RING1-7610M | Recombinant Mouse RING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RING1-2337HCL | Recombinant Human RING1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RING1 Products
Required fields are marked with *
My Review for All RING1 Products
Required fields are marked with *
0
Inquiry Basket