Recombinant Human RHOD Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RHOD-1868H
Product Overview : RHOD MS Standard C13 and N15-labeled recombinant protein (NP_055393) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 23.5 kDa
AA Sequence : MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RHOD ras homolog family member D [ Homo sapiens (human) ]
Official Symbol RHOD
Synonyms RHOD; ras homolog family member D; ARHD, ras homolog gene family, member D; rho-related GTP-binding protein RhoD; Rho; Rho related GTP binding protein RhoD; Rho related protein HP1; RhoD; RhoHP1; ras homolog D; Rho-related protein HP1; ras homolog gene family, member A; ras homolog gene family, member D; ARHD; RHOM; RHOHP1;
Gene ID 29984
mRNA Refseq NM_014578
Protein Refseq NP_055393
MIM 605781
UniProt ID O00212

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RHOD Products

Required fields are marked with *

My Review for All RHOD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon