Recombinant Human RHOD Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RHOD-1868H |
Product Overview : | RHOD MS Standard C13 and N15-labeled recombinant protein (NP_055393) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 23.5 kDa |
AA Sequence : | MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RHOD ras homolog family member D [ Homo sapiens (human) ] |
Official Symbol | RHOD |
Synonyms | RHOD; ras homolog family member D; ARHD, ras homolog gene family, member D; rho-related GTP-binding protein RhoD; Rho; Rho related GTP binding protein RhoD; Rho related protein HP1; RhoD; RhoHP1; ras homolog D; Rho-related protein HP1; ras homolog gene family, member A; ras homolog gene family, member D; ARHD; RHOM; RHOHP1; |
Gene ID | 29984 |
mRNA Refseq | NM_014578 |
Protein Refseq | NP_055393 |
MIM | 605781 |
UniProt ID | O00212 |
◆ Recombinant Proteins | ||
RHOD-1629H | Recombinant Human Ras Homolog Gene Family, Member D, His-tagged | +Inquiry |
RHOD-2293H | Recombinant Human RHOD, His-tagged | +Inquiry |
RHOD-1868H | Recombinant Human RHOD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RHOD-30391TH | Recombinant Human RHOD, His-tagged | +Inquiry |
RHOD-968H | Recombinant Human Rho-Related GTP-Binding Protein RHOD, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOD-2350HCL | Recombinant Human RHOD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RHOD Products
Required fields are marked with *
My Review for All RHOD Products
Required fields are marked with *
0
Inquiry Basket