Recombinant Human RCC1 Protein, GST-Tagged

• Cat.No.: RCC1-1326H
• Product Overview: Human CHC1 partial ORF (AAH07300, 312 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: RCC1 (Regulator Of Chromosome Condensation 1) is a Protein Coding gene. Diseases associated with RCC1 include Renal-Hepatic-Pancreatic Dysplasia and Retinitis Pigmentosa. Among its related pathways are HIV Life Cycle and Ran Pathway. GO annotations related to this gene include chromatin binding and nucleosomal DNA binding. An important paralog of this gene is RPGR.
• Molecular Mass: 37.73 kDa
• AA Sequence: EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RCC1 regulator of chromosome condensation 1 [ Homo sapiens ]
• Official Symbol: RCC1
• Synonyms: RCC1; regulator of chromosome condensation 1; CHC1, chromosome condensation 1; regulator of chromosome condensation; cell cycle regulatory protein; SNHG3-RCC1 readthrough transcript; guanine nucleotide-releasing protein; CHC1; RCC1-I; SNHG3-RCC1
• Gene ID: 1104
• mRNA Refseq: NM_001048194
• Protein Refseq: NP_001041659
• MIM: 179710
• UniProt ID: P18754