Recombinant Human RALB, His-tagged

• Cat.No.: RALB-28237TH
• Product Overview: Recombinant full length Human RALB with an N terminal His tag; 227 amino acids with tag, Predicted MWt 25.6 kDa.

Specification

• Description: This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors.
• Protein length: 203 amino acids
• Conjugation: HIS
• Molecular Weight: 25.600kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERC

Gene Information

• Gene Name: RALB v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) [ Homo sapiens ]
• Official Symbol: RALB
• Synonyms: RALB; v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein); ras-related protein Ral-B
• Gene ID: 5899
• mRNA Refseq: NM_002881
• Protein Refseq: NP_002872
• MIM: 179551
• Uniprot ID: P11234
• Chromosome Location: 2q14.2
• Pathway: CXCR4-mediated signaling events, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Pancreatic cancer, organism-specific biosystem; Pancreatic cancer, conserved biosystem
• Function: GTP binding; GTP binding; GTPase activity; GTPase activity; nucleotide binding