Recombinant Human RAD18
Cat.No. : | RAD18-29579TH |
Product Overview : | Recombinant fragment corresponding to aa 332-430 of human RAD18 with a proprietary tag; 36.52 inclusive of tag; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif.Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. |
Molecular Weight : | 36.520kDa |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: (Glutathione is reduced) |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV |
Sequence Similarities : | Belongs to the RAD18 family.Contains 1 RING-type zinc finger.Contains 1 SAP domain.Contains 1 UBZ-type zinc finger. |
Gene Name | RAD18 RAD18 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RAD18 |
Synonyms | RAD18; RAD18 homolog (S. cerevisiae); E3 ubiquitin-protein ligase RAD18; RNF73; |
Gene ID | 56852 |
mRNA Refseq | NM_020165 |
Protein Refseq | NP_064550 |
MIM | 605256 |
Uniprot ID | Q9NS91 |
Chromosome Location | 3p25-p24 |
Function | Y-form DNA binding; damaged DNA binding; ligase activity; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
RAD18-529HFL | Active Recombinant Full Length Human RAD18 Protein, C-Flag-tagged | +Inquiry |
RAD18-10488Z | Recombinant Zebrafish RAD18 | +Inquiry |
RAD18-2315C | Recombinant Chicken RAD18 | +Inquiry |
RAD18-1151H | Recombinant Human RAD18 Protein (1-495 aa), His-SUMO-tagged | +Inquiry |
RAD18-421HF | Active Recombinant Full Length Human RAD18 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD18-2561HCL | Recombinant Human RAD18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAD18 Products
Required fields are marked with *
My Review for All RAD18 Products
Required fields are marked with *
0
Inquiry Basket