Recombinant Human RAD18 Protein (1-495 aa), His-SUMO-tagged
Cat.No. : | RAD18-1151H |
Product Overview : | Recombinant Human RAD18 Protein (1-495 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-495 aa |
Description : | E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 72.2 kDa |
AA Sequence : | MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | RAD18 RAD18 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RAD18 |
Synonyms | RAD18; RNF73; hHR18; hRAD18; |
Gene ID | 56852 |
mRNA Refseq | NM_020165 |
Protein Refseq | NP_064550 |
MIM | 605256 |
UniProt ID | Q9NS91 |
◆ Recombinant Proteins | ||
RAD18-1848H | Recombinant Human RAD18 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAD18-29578TH | Recombinant Human RAD18 | +Inquiry |
RAD18-2315C | Recombinant Chicken RAD18 | +Inquiry |
RAD18-529HFL | Active Recombinant Full Length Human RAD18 Protein, C-Flag-tagged | +Inquiry |
RAD18-421HF | Active Recombinant Full Length Human RAD18 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD18-2561HCL | Recombinant Human RAD18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAD18 Products
Required fields are marked with *
My Review for All RAD18 Products
Required fields are marked with *
0
Inquiry Basket