Recombinant Human RAD18 Protein (1-495 aa), His-SUMO-tagged
| Cat.No. : | RAD18-1151H |
| Product Overview : | Recombinant Human RAD18 Protein (1-495 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity. |
| Source : | E. coli |
| Species : | Human |
| Tag : | His&SUMO |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 72.2 kDa |
| Protein length : | 1-495 aa |
| AA Sequence : | MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | RAD18 RAD18 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | RAD18 |
| Synonyms | RAD18; RNF73; hHR18; hRAD18; |
| Gene ID | 56852 |
| mRNA Refseq | NM_020165 |
| Protein Refseq | NP_064550 |
| MIM | 605256 |
| UniProt ID | Q9NS91 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAD18 Products
Required fields are marked with *
My Review for All RAD18 Products
Required fields are marked with *
0
Inquiry Basket
