Recombinant Human QPCTL Protein (212-382 aa), His-SUMO-tagged

• Cat.No.: QPCTL-1126H
• Product Overview: Recombinant Human QPCTL Protein (212-382 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 212-382 aa
• Description: Responsible for the biosynthesis of pyroglutamyl peptides.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 35.5 kDa
• AA Sequence: AAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: QPCTL glutaminyl-peptide cyclotransferase-like [ Homo sapiens ]
• Official Symbol: QPCTL
• Synonyms: QPCTL; FLJ20084; isoQC; gQC
• Gene ID: 54814
• mRNA Refseq: NM_001163377
• Protein Refseq: NP_001156849
• UniProt ID: Q9NXS2