Recombinant Full Length Macaca Fascicularis Glutaminyl-Peptide Cyclotransferase-Like Protein(Qpctl) Protein, His-Tagged
Cat.No. : | RFL6303MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Glutaminyl-peptide cyclotransferase-like protein(QPCTL) Protein (Q4R942) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MRSGGRGRPRLRLGERGVMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTE ELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWGTYLRPLLVVRTPGSPGNLQVRKFLE ATLRSLTAGWHVELDPFTASTPLGPVDFGNVVATLDPGAARHLTLACHYDSKLFPPGSTP FVGATDSAVPCALLLELAQALDLELSRAKEQAAPVTLQLLFLDGEEALKEWGPKDSLYGS RHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLH RLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEANL HPPTVHNLSRILAVFLAEYLGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | QPCTL |
Synonyms | QPCTL; QtsA-10761; Glutaminyl-peptide cyclotransferase-like protein; Golgi-resident glutaminyl-peptide cyclotransferase; isoQC; gQC |
UniProt ID | Q4R942 |
◆ Recombinant Proteins | ||
QPCTL-5951H | Recombinant Human QPCTL Protein (Ser53-Leu382), N-His tagged | +Inquiry |
QPCTL-575C | Recombinant Cynomolgus Monkey QPCTL Protein, His (Fc)-Avi-tagged | +Inquiry |
QPCTL-832C | Recombinant Cynomolgus QPCTL Protein, His-tagged | +Inquiry |
QPCTL-16H | Recombinant Human QPCTL protein, GST-tagged | +Inquiry |
QPCTL-3543R | Recombinant Rhesus Macaque QPCTL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
QPCTL-7323M | Recombinant Mouse QPCTL Protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
QPCTL-2133HCL | Recombinant Human QPCTL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All QPCTL Products
Required fields are marked with *
My Review for All QPCTL Products
Required fields are marked with *
0
Inquiry Basket