Recombinant Mouse QPCTL Protein, His-Avi-tagged, Biotinylated

• Cat.No.: QPCTL-7323M
• Product Overview: Biotinylated recombinant Mouse QPCTL Protein with His-Avi tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Avi&His&Non
• Protein Length: 60-383 aa
• Description: Predicted to enable glutaminyl-peptide cyclotransferase activity and zinc ion binding activity. Predicted to be located in Golgi apparatus. Orthologous to human QPCTL (glutaminyl-peptide cyclotransferase like).
• Molecular Mass: 39 kDa
• AASequence: HHHHHHHHGSGLNDIFEAQKIEWHEVEEMSRSRDLRVPLIGSLSEAKLRLVVGQLDPQRLWGTFLRPLLIVRPPGSSGNLQVRKFLEATLQSLSAGWHVELDPFTASTPLGPLDFGNVVATLDPGAARHLTLACHYDSKFFPPGLPPFVGATDSAVPCALLLELVQALDAMLSRIKQQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQIMESIPHSPGPTRIQAIELFVLLDLLGASSPIFFSHFPRTARWFQRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPPGPVEDDHIPFLRRGVPVLHLIATPFPAVWHTPADTEANLHPPTVHNLSRILAVFLAEYLGL
• Endotoxin: <1EU/μg by LAL
• Purity: >90% by SDS-PAGE
• Labeling efficiency: 2.01 by HABA
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.69 mg/mL by BCA

Gene Information

• Gene Name: Qpctl glutaminyl-peptide cyclotransferase-like [ Mus musculus (house mouse) ]
• Official Symbol: QPCTL
• Synonyms: QPCTL; glutaminyl-peptide cyclotransferase-like; glutaminyl-peptide cyclotransferase-like protein; isoQC; golgi-resident glutaminyl-peptide cyclotransferase; gQC; BB101812; 1810019P04Rik
• Gene ID: 67369
• mRNA Refseq: NM_026111
• Protein Refseq: NP_080387
• UniProt ID: Q8BH73