Recombinant Human PURA

Cat.No. : PURA-31266TH
Product Overview : Recombinant fragment of Human PURA with N terminal proprietary tag, 37.73kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGT SLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYK VWAKFGHTFCKYSEEMKKIQEKQREKRAAC
Sequence Similarities : Belongs to the PUR DNA-binding protein family.
Gene Name PURA purine-rich element binding protein A [ Homo sapiens ]
Official Symbol PURA
Synonyms PURA; purine-rich element binding protein A; transcriptional activator protein Pur-alpha; PUR ALPHA; PUR1; PURALPHA;
Gene ID 5813
mRNA Refseq NM_005859
Protein Refseq NP_005850
MIM 600473
Uniprot ID Q00577
Chromosome Location 5q31
Pathway Diurnally regulated genes with circadian orthologs, organism-specific biosystem;
Function DNA binding; SMAD binding; double-stranded telomeric DNA binding; protein binding; purine-rich negative regulatory element binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PURA Products

Required fields are marked with *

My Review for All PURA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon