Recombinant Human PURA

• Cat.No.: PURA-31263TH
• Product Overview: Recombinant fragment of Human PURA with N terminal proprietary tag, 31.24kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 51 amino acids
• Description: This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia.
• Molecular Weight: 31.240kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRA
• Sequence Similarities: Belongs to the PUR DNA-binding protein family.

Gene Information

• Gene Name: PURA purine-rich element binding protein A [ Homo sapiens ]
• Official Symbol: PURA
• Synonyms: PURA; purine-rich element binding protein A; transcriptional activator protein Pur-alpha; PUR ALPHA; PUR1; PURALPHA
• Gene ID: 5813
• mRNA Refseq: NM_005859
• Protein Refseq: NP_005850
• MIM: 600473
• Uniprot ID: Q00577
• Chromosome Location: 5q31
• Pathway: Diurnally regulated genes with circadian orthologs, organism-specific biosystem
• Function: DNA binding; SMAD binding; double-stranded telomeric DNA binding; protein binding; purine-rich negative regulatory element binding