Recombinant Human PTPRZ1 Protein (36-300 aa), His-tagged

• Cat.No.: PTPRZ1-2344H
• Product Overview: Recombinant Human PTPRZ1 Protein (36-300 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 36-300 aa
• Description: Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the bryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual mory, probably via the dephosphorylation of proteins that are part of important signaling cascades.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 32.1 kDa
• AA Sequence: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: PTPRZ1 protein tyrosine phosphatase, receptor-type, Z polypeptide 1 [ Homo sapiens ]
• Official Symbol: PTPRZ1
• Synonyms: PTPRZ1; PTPRZ, PTPZ; phosphacan; PTP18; RPTPB; R-PTP-zeta-2; PTPZ; HPTPZ; PTPRZ; HPTPzeta; PTP-ZETA; RPTPbeta
• Gene ID: 5803
• mRNA Refseq: NM_001206838
• Protein Refseq: NP_001193767
• MIM: 176891
• UniProt ID: P23471