Recombinant Human PTPRZ1 protein, His-tagged

• Cat.No.: PTPRZ1-3393H
• Product Overview: Recombinant Human PTPRZ1 protein(P23471)(36-300aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 36-300aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.1 kDa
• AA Sequence: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PTPRZ1 protein tyrosine phosphatase, receptor-type, Z polypeptide 1 [ Homo sapiens ]
• Official Symbol: PTPRZ1
• Synonyms: PTPRZ1; protein tyrosine phosphatase, receptor-type, Z polypeptide 1; PTPRZ, PTPZ; receptor-type tyrosine-protein phosphatase zeta; phosphacan; PTP18; RPTPB; R-PTP-zeta-2; receptor-type tyrosine phosphatase beta/zeta; protein-tyrosine phosphatase receptor type Z polypeptide 2; protein tyrosine phosphatase, receptor-type, zeta polypeptide 1; PTPZ; HPTPZ; PTPRZ; HPTPzeta; PTP-ZETA; RPTPbeta
• Gene ID: 5803
• mRNA Refseq: NM_001206838
• Protein Refseq: NP_001193767
• MIM: 176891
• UniProt ID: P23471