Recombinant Human PTHLH Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PTHLH-6703H
Product Overview : PTHLH MS Standard C13 and N15-labeled recombinant protein (NP_002811) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone.
Molecular Mass : 19.9 kDa
AA Sequence : MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PTHLH parathyroid hormone-like hormone [ Homo sapiens (human) ]
Official Symbol PTHLH
Synonyms PTHLH; parathyroid hormone-like hormone; parathyroid hormone-related protein; HHM; osteostatin; PLP; PTHR; PTHRP; PTH-rP; PTH-related protein; parathyroid hormone-like related protein; BDE2; MGC14611;
Gene ID 5744
mRNA Refseq NM_002820
Protein Refseq NP_002811
MIM 168470
UniProt ID P12272

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PTHLH Products

Required fields are marked with *

My Review for All PTHLH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon