Recombinant Human PTHLH protein, His/S-tagged
Cat.No. : | PTHLH-113H |
Product Overview : | Recombinant Human PTHLH protein (Ala37-His177), fused to His/S-tag at N-terminus, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&S |
Protein Length : | 193 |
Description : | The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. |
Form : | Supplied as lyophilized form in PBS, pH7.4, containing 1mM DTT, 5% trehalose, 0.01% sarcosyl and preservative. |
Molecular Mass : | 21.7kDa |
AA Sequence : | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH |
Endotoxin : | <1.0 EU per 1µg (determined by the LAL method). |
Purity : | >95% |
Applications : | SDS-PAGE; WB; ELISA; IP. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Reconstitution : | Reconstitute in sterile PBS, pH7.2 - pH7.4. |
Gene Name | PTHLH |
Official Symbol | PTHLH |
Synonyms | HHM; PLP; BDE2; PTHR; PTHRP |
Gene ID | 5744 |
mRNA Refseq | NM_198965.2 |
Protein Refseq | NP_945316.1 |
MIM | 168470 |
UniProt ID | P12272 |
◆ Recombinant Proteins | ||
PTHLH-7765D | Recombinant Dog PTHLH protein, His & S-tagged | +Inquiry |
PTHLH-666H | Recombinant Human PTHLH Protein, His-tagged | +Inquiry |
PTHLH-3695R | Recombinant Rhesus monkey PTHLH Protein, His-tagged | +Inquiry |
Pthlh-7767M | Recombinant Mouse Pthlh protein, His-tagged | +Inquiry |
Pthlh-7768R | Recombinant Rat Pthlh protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTHLH-2701HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2702HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2703HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTHLH Products
Required fields are marked with *
My Review for All PTHLH Products
Required fields are marked with *
0
Inquiry Basket