Recombinant Human PSMC3IP protein, T7/His-tagged

• Cat.No.: PSMC3IP-153H
• Product Overview: Recombinant human HOP2 cDNA (216 aa, Isoform-II) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 216 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVV VKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALT TPEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQ FFEEVGIETDEDYNVTLPDP
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: PSMC3IP PSMC3 interacting protein [ Homo sapiens ]
• Official Symbol: PSMC3IP
• Synonyms: PSMC3IP; PSMC3 interacting protein; homologous-pairing protein 2 homolog; GT198; HUMGT198A; TBP 1 interacting protein; TBPIP; DBD-interacting; TBP-1-interacting protein; nuclear receptor coactivator GT198; tat-binding protein 1-interacting protein; proteasome 26S ATPase subunit 3-interacting protein; HOP2; ODG3
• Gene ID: 29893
• mRNA Refseq: NM_001256014
• Protein Refseq: NP_001242943
• MIM: 608665
• UniProt ID: Q9P2W1
• Chromosome Location: 17q21.2
• Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Meiosis, organism-specific biosystem; Meiotic Recombination, organism-specific biosystem
• Function: DBD domain binding; DNA binding; androgen receptor binding; estrogen receptor binding; glucocorticoid receptor binding; ligand-dependent nuclear receptor transcription coactivator activity; protein homodimerization activity; thyroid hormone receptor bindi