Recombinant Human PSMB2, His-tagged

• Cat.No.: PSMB2-31209TH
• Product Overview: Recombinant full length, Human Proteasome subunit beta type 2 (amino acids 1-201) with an N terminal His tag, predicted Mwt: 24.9 kDa inclusive of tags.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 201 amino acids
• Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 24.900kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:30% Glycerol, 0.02% DTT, 0.32% Tris HCl, 0.58% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEYLIGIQGPDYVLVASDRV AASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHV NLLLAGYDEHEGPALYYMDY LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQG S
• Sequence Similarities: Belongs to the peptidase T1B family.

Gene Information

• Gene Name: PSMB2 proteasome (prosome, macropain) subunit, beta type, 2 [ Homo sapiens ]
• Official Symbol: PSMB2
• Synonyms: PSMB2; proteasome (prosome, macropain) subunit, beta type, 2; proteasome subunit beta type-2; HC7 I
• Gene ID: 5690
• mRNA Refseq: NM_001199779
• Protein Refseq: NP_001186708
• MIM: 602175
• Uniprot ID: P49721
• Chromosome Location: 1p34.2
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: peptidase activity; threonine-type endopeptidase activity