Recombinant Human PSMB2, His-tagged

Cat.No. : PSMB2-30366TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-201 of Human Proteasome subunit beta type 2 with N terminal His tag, 21kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-201 a.a.
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 115 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSE KILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPT AAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALY YMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNI SFPKQGS
Sequence Similarities : Belongs to the peptidase T1B family.
Full Length : Full L.
Gene Name PSMB2 proteasome (prosome, macropain) subunit, beta type, 2 [ Homo sapiens ]
Official Symbol PSMB2
Synonyms PSMB2; proteasome (prosome, macropain) subunit, beta type, 2; proteasome subunit beta type-2; HC7 I;
Gene ID 5690
mRNA Refseq NM_001199779
Protein Refseq NP_001186708
MIM 602175
Uniprot ID P49721
Chromosome Location 1p34.2
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function peptidase activity; threonine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PSMB2 Products

Required fields are marked with *

My Review for All PSMB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon