Recombinant Human PSEN2

• Cat.No.: PSEN2-28527TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-86 of Human Presenilin 2 with an N terminal proprietary tag; Predicted MWt 35.09 kDa.

Specification

• Description: Alzheimers disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.
• Protein length: 86 amino acids
• Molecular Weight: 35.090kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Isoform 1 is seen in the placenta, skeletal muscle and heart while isoform 2 is seen in the heart, brain, placenta, liver, skeletal muscle and kidney.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAK
• Sequence Similarities: Belongs to the peptidase A22A family.
• Tag: Non

Gene Information

• Gene Name: PSEN2 presenilin 2 (Alzheimer disease 4) [ Homo sapiens ]
• Official Symbol: PSEN2
• Synonyms: PSEN2; presenilin 2 (Alzheimer disease 4); AD4; presenilin-2; AD3L; PS2; STM2
• Gene ID: 5664
• mRNA Refseq: NM_000447
• Protein Refseq: NP_000438
• MIM: 600759
• Uniprot ID: P49810
• Chromosome Location: 1q31-q42
• Pathway: A third proteolytic cleavage releases NICD, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem
• Function: aspartic-type endopeptidase activity; endopeptidase activity; endopeptidase activity; peptidase activity; protein binding