Recombinant Human presenilin 2 (Alzheimer disease 4) Protein, His-tagged

• Cat.No.: PSEN2-28H
• Product Overview: Recombinant Human PSEN2 Protein (305-384aa) with His-tag was expressed in E. coli.

Specification

• Description: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.
• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 305-384aa
• Molecular Mass: 10 kDa
• AA Sequence: MAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH7.4

Gene Information

• Gene Name: PSEN2 presenilin 2 (Alzheimer disease 4) [Homo sapiens (human)]
• Official Symbol: PSEN2
• Synonyms: PSEN2; presenilin 2 (Alzheimer disease 4); AD4; presenilin-2; AD3L; PS2; STM2; AD5; E5-1; PS-2; AD3LP; STM-2; CMD1V
• Gene ID: 5664
• mRNA Refseq: NM_000447
• Protein Refseq: NP_000438
• MIM: 600759
• UniProt ID: P49810