Recombinant Human PRNP Protein, His-tagged

• Cat.No.: PRNP-118H
• Product Overview: Recombinant Human PRNP Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The PRNP gene encodes the major prion protein (PrP, CD230), a widely-expressed glycoprotein expressed at high levels in the central nervous system. While the typical cellular function of PrP is not well defined, it is a putative antioxidant and a metal-binding protein that may be involved in signal transduction. Prion proteins can adopt different conformations; the cellular PrPc prion protein may be converted following translation into the β-sheet-rich scrapie isoform (PrPsc) responsible for several prion diseases, including bovine spongiform encephalopathy and human Creutzfeldt-Jakob disease. Unlike most neurodegenerative diseases, prion diseases are infectious as prions are capable of propagating by conferring an abnormally folded state onto properly folded cellular proteins. In addition, the cellular PrPc has may be involved in β-amyloid peptide oligomerization and synaptic toxicity.
• Molecular Mass: ~30 kDa
• AA Sequence: MKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: PRNP prion protein [ Homo sapiens (human) ]
• Official Symbol: PRNP
• Synonyms: PRNP; prion protein; CJD, GSS, prion protein (p27 30) , PRIP; major prion protein; CD230; Creutzfeldt Jakob disease; fatal familial insomnia; Gerstmann Strausler Scheinker syndrome; p27 30; PRP; CD230 antigen; prion-related protein; CJD; GSS; PrP; ASCR; PRIP; PrPc; p27-30; PrP27-30; PrP33-35C; MGC26679
• Gene ID: 5621
• mRNA Refseq: NM_000311
• Protein Refseq: NP_000302
• MIM: 176640
• UniProt ID: P04156