Recombinant Cervid PRNP Protein, His-tagged

• Cat.No.: PRP-01C
• Product Overview: Recombinant Cervid PRNP Protein with a His tag was expressed in E. coli.

Specification

• Species: Cervid
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants.
• Molecular Mass: ~ 17.3 kDa, reducing conditions
• AA Sequence: MGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQLEHHHHHH
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.11 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in PBS, pH 8.0

Gene Information

• Gene Name: PRNP prion protein [ Cervus canadensis ]
• Official Symbol: PRNP
• Synonyms: PRNP; prion protein; PrP; major prion protein; prion protein PrP
• Gene ID: 122448236
• mRNA Refseq: XM_043479407
• Protein Refseq: XP_043335342
• UniProt ID: P79142