Recombinant Human PRNP Protein

• Cat.No.: PRNP-388H
• Product Overview: Recombinant Human PRNP(23-230 aa) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• ProteinLength: 23-230 aa
• Description: Prion Protein (PrP) is an abundant cellular protein in mammalian neural tissue. It is associated with mammalian prion diseases, e.g. transmissible spongiforme encephalophathies that include human Creutzfeld-Jakob disease, bovine spongiforme encephalopathy, sheep scrapie, cervid’s chronic wasting disease and various rodent prion diseases. In the disease process, PrP undergoes protein aggregation into disease specific PrPSc.
• Form: Finally dialysed in pure water, shock frozen in liquid nitrogen at 250 µg per vial
• Molecular Mass: 22891 g/mol
• AA Sequence: GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPI
  IHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS
• Purity: > 95% by SDS-PAGE
• Applications: Prion Protein is frequently used in analytical aggregation assays
• Notes: Thawing: Gentle agitation at 37 centigrade until no ice is left. Keep on ice. Do not refreeze
• Storage: Store at -80 centigrade

Gene Information

• Gene Name: PRNP prion protein [ Homo sapiens ]
• Official Symbol: PRNP
• Synonyms: PRNP; prion protein; CJD, GSS, prion protein (p27 30) , PRIP; major prion protein; CD230; Creutzfeldt Jakob disease; fatal familial insomnia; Gerstmann Strausler Scheinker syndrome; p27 30; PRP; CD230 antigen; prion-related protein; CJD; GSS; PrP; ASCR; PRIP; PrPc; p27-30; PrP27-30; PrP33-35C; MGC26679
• Gene ID: 5621
• mRNA Refseq: NM_000311
• Protein Refseq: NP_000302
• MIM: 176640
• UniProt ID: P04156