Recombinant Human PRAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRAP1-4936H
Product Overview : PRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001138673) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PRAP1 (Proline Rich Acidic Protein 1) is a Protein Coding gene. Diseases associated with PRAP1 include Hepatocellular Carcinoma. Among its related pathways are Autophagy - animal. An important paralog of this gene is ZNF511-PRAP1.
Molecular Mass : 16.2 kDa
AA Sequence : MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRAP1 proline-rich acidic protein 1 [ Homo sapiens (human) ]
Official Symbol PRAP1
Synonyms PRAP1; proline-rich acidic protein 1; UPA; PRO1195; RP11-122K13.6; MGC126792;
Gene ID 118471
mRNA Refseq NM_001145201
Protein Refseq NP_001138673
MIM 609776
UniProt ID Q96NZ9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PRAP1 Products

Required fields are marked with *

My Review for All PRAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon