Recombinant Human PRAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRAP1-4936H |
Product Overview : | PRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001138673) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | PRAP1 (Proline Rich Acidic Protein 1) is a Protein Coding gene. Diseases associated with PRAP1 include Hepatocellular Carcinoma. Among its related pathways are Autophagy - animal. An important paralog of this gene is ZNF511-PRAP1. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 16.2 kDa |
AA Sequence : | MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRAP1 proline-rich acidic protein 1 [ Homo sapiens (human) ] |
Official Symbol | PRAP1 |
Synonyms | PRAP1; proline-rich acidic protein 1; UPA; PRO1195; RP11-122K13.6; MGC126792; |
Gene ID | 118471 |
mRNA Refseq | NM_001145201 |
Protein Refseq | NP_001138673 |
MIM | 609776 |
UniProt ID | Q96NZ9 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PRAP1 Products
Required fields are marked with *
My Review for All PRAP1 Products
Required fields are marked with *
0
Inquiry Basket