Recombinant Human PRAP1, His-tagged
Cat.No. : | PRAP1-175H |
Product Overview : | Recombinant Human Proline-Rich Acidic Protein 1/PRAP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val21-Gln151) of Human PRAP1 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-151 a.a. |
AA Sequence : | VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPI LPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHP QVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | PRAP1 proline-rich acidic protein 1 [ Homo sapiens ] |
Official Symbol | PRAP1 |
Synonyms | PRAP1; proline-rich acidic protein 1; UPA; PRO1195; RP11-122K13.6; MGC126792; |
Gene ID | 118471 |
mRNA Refseq | NM_001145201 |
Protein Refseq | NP_001138673 |
MIM | 609776 |
UniProt ID | Q96NZ9 |
Chromosome Location | 10q26.3 |
◆ Recombinant Proteins | ||
PRAP1-4936H | Recombinant Human PRAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRAP1-5609H | Recombinant Human PRAP1 Protein (Gln21-Gln151), C-His tagged | +Inquiry |
Prap1-5096M | Recombinant Mouse Prap1 Protein, Myc/DDK-tagged | +Inquiry |
PRAP1-4229H | Recombinant Human PRAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRAP1-369H | Recombinant Human PRAP1 protein(Met1-Gln151), mFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRAP1-001HCL | Recombinant Human PRAP1 cell lysate | +Inquiry |
PRAP1-002HCL | Recombinant Human PRAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRAP1 Products
Required fields are marked with *
My Review for All PRAP1 Products
Required fields are marked with *
0
Inquiry Basket