Recombinant Human PRAP1, His-tagged

Cat.No. : PRAP1-175H
Product Overview : Recombinant Human Proline-Rich Acidic Protein 1/PRAP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val21-Gln151) of Human PRAP1 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 21-151 a.a.
AA Sequence : VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPI LPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHP QVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name PRAP1 proline-rich acidic protein 1 [ Homo sapiens ]
Official Symbol PRAP1
Synonyms PRAP1; proline-rich acidic protein 1; UPA; PRO1195; RP11-122K13.6; MGC126792;
Gene ID 118471
mRNA Refseq NM_001145201
Protein Refseq NP_001138673
MIM 609776
UniProt ID Q96NZ9
Chromosome Location 10q26.3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PRAP1 Products

Required fields are marked with *

My Review for All PRAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon