Recombinant Human PPY
Cat.No. : | PPY-30779TH |
Product Overview : | Recombinant full length Human Pancreatic Polypeptide with N terminal proprietary tag, 36.19kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 95 amino acids |
Description : | This gene belongs to the NPY family and it encodes a protein that is synthesized as a 95 aa polypeptide precursor in the pancreatic islets of Langerhans. It is cleaved into two peptide products; the active hormone of 36 aa and an icosapeptide of unknown function. The hormone acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma level of this hormone has been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa. In addition, infusion of this hormone in obese rodents has shown to decrease weight gain. |
Molecular Weight : | 36.190kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL |
Gene Name | PPY pancreatic polypeptide [ Homo sapiens ] |
Official Symbol | PPY |
Synonyms | PPY; pancreatic polypeptide; pancreatic prohormone; pancreatic polypeptide Y; PNP; |
Gene ID | 5539 |
mRNA Refseq | NM_002722 |
Protein Refseq | NP_002713 |
MIM | 167780 |
Uniprot ID | P01298 |
Chromosome Location | 17p11.1-qter |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; |
Function | G-protein coupled receptor binding; hormone activity; receptor binding; |
◆ Recombinant Proteins | ||
PPY-6742H | Recombinant Human PPY protein, His & GST-tagged | +Inquiry |
PPY-30779TH | Recombinant Human PPY | +Inquiry |
PPY-214H | Recombinant Human PPY Protein, His-tagged | +Inquiry |
PPY-3583R | Recombinant Rhesus monkey PPY Protein, His-tagged | +Inquiry |
PPY-4308R | Recombinant Rat PPY Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPY-1408HCL | Recombinant Human PPY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPY Products
Required fields are marked with *
My Review for All PPY Products
Required fields are marked with *
0
Inquiry Basket