Recombinant Human PPY

• Cat.No.: PPY-30779TH
• Product Overview: Recombinant full length Human Pancreatic Polypeptide with N terminal proprietary tag, 36.19kDa.

Specification

• Description: This gene belongs to the NPY family and it encodes a protein that is synthesized as a 95 aa polypeptide precursor in the pancreatic islets of Langerhans. It is cleaved into two peptide products; the active hormone of 36 aa and an icosapeptide of unknown function. The hormone acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma level of this hormone has been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa. In addition, infusion of this hormone in obese rodents has shown to decrease weight gain.
• Protein length: 95 amino acids
• Molecular Weight: 36.190kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
• Tag: Non

Gene Information

• Gene Name: PPY pancreatic polypeptide [ Homo sapiens ]
• Official Symbol: PPY
• Synonyms: PPY; pancreatic polypeptide; pancreatic prohormone; pancreatic polypeptide Y; PNP
• Gene ID: 5539
• mRNA Refseq: NM_002722
• Protein Refseq: NP_002713
• MIM: 167780
• Uniprot ID: P01298
• Chromosome Location: 17p11.1-qter
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem
• Function: G-protein coupled receptor binding; hormone activity; receptor binding