Recombinant Human PPY Protein, His-tagged

• Cat.No.: PPY-214H
• Product Overview: Recombinant Human PPY fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 30-88 a.a.
• Description: The physiological role for the icosapeptide has not yet been elucidated.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4
• Molecular Mass: 7.8kD
• AA Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: PPY pancreatic polypeptide [ Homo sapiens ]
• Official Symbol: PPY
• Synonyms: PPY; pancreatic polypeptide; pancreatic prohormone; pancreatic polypeptide Y; PNP; PP
• Gene ID: 5539
• mRNA Refseq: NM_002722
• Protein Refseq: NP_002713
• MIM: 167780
• UniProt ID: P01298